Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (7 PDB entries) |
Domain d5t9pa_: 5t9p A: [326329] automated match to d1d8za_ complexed with cl, so4 |
PDB Entry: 5t9p (more details), 2 Å
SCOPe Domain Sequences for d5t9pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t9pa_ d.58.7.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} eysgiiyvsrlphgfhekelskyfaqfgdlkevrlarnkktgnsrhygflefvnkedami aqesmnnyllmghllqvrvlpkgakieklykykkrvl
Timeline for d5t9pa_: