SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t9pa_ (5t9p A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2174486Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2175050Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2175051Protein automated matches [190896] (10 species)
    not a true protein
  7. 2175065Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (6 PDB entries)
  8. 2283028Domain d5t9pa_: 5t9p A: [326329]
    automated match to d1d8za_
    complexed with cl, so4

Details for d5t9pa_

PDB Entry: 5t9p (more details), 2 Å

PDB Description: structural analysis reveals the flexible c-terminus of nop15 undergoes rearrangement to recognize a pre-ribosomal rna folding intermediate
PDB Compounds: (A:) Ribosome biogenesis protein 15

SCOPe Domain Sequences for d5t9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t9pa_ d.58.7.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
eysgiiyvsrlphgfhekelskyfaqfgdlkevrlarnkktgnsrhygflefvnkedami
aqesmnnyllmghllqvrvlpkgakieklykykkrvl

SCOPe Domain Coordinates for d5t9pa_:

Click to download the PDB-style file with coordinates for d5t9pa_.
(The format of our PDB-style files is described here.)

Timeline for d5t9pa_:

  • d5t9pa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17