SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5te6l2 (5te6 L:107-214)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (633 PDB entries)
  8. 2283027Domain d5te6l2: 5te6 L:107-214 [326328]
    Other proteins in same PDB: d5te6l1
    automated match to d1dn0a2
    complexed with epe, nag

Details for d5te6l2

PDB Entry: 5te6 (more details), 2.4 Å

PDB Description: crystal structure of broadly neutralizing vrc01-class antibody n6 in complex with hiv-1 clade ae strain 93th057 gp120 core
PDB Compounds: (L:) Light chain of N6

SCOPe Domain Sequences for d5te6l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5te6l2 b.1.1.2 (L:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5te6l2:

Click to download the PDB-style file with coordinates for d5te6l2.
(The format of our PDB-style files is described here.)

Timeline for d5te6l2:

  • d5te6l2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17