SCOPe 2.06: Domain d5te6l1: 5te6 L:1-106

Lineage for d5te6l1 (5te6 L:1-106)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5te6l1: 5te6 L:1-106 [326327]
   Other proteins in same PDB: d5te6l2
   automated match to d1dn0a1
   complexed with epe, nag

Details for d5te6l1

PDB Entry: 5te6, 2.4 Å

PDB Description: crystal structure of broadly neutralizing vrc01-class antibody n6 in complex with hiv-1 clade ae strain 93th057 gp120 core

PDB Compounds: (L:) Light chain of N6

SCOPe Domain Sequences for d5te6l1:

Sequence; same for both SEQRES and ATOM records:

>d5te6l1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yihvtqspsslsvsigdrvtincqtsqgvgsdlhwyqhkpgrapkllihhtssvedgvps
rfsgsgfhtsfnltisdlqaddiatyycqvlqffgrgsrlhi

Timeline for d5te6l1:

• d5te6l1 is new in SCOPe 2.06-stable
  
• d5te6l1 appears in SCOPe 2.07
  
• d5te6l1 appears in the current release, SCOPe 2.08