Lineage for d5tkaa_ (5tka A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (8 species)
    not a true protein
  7. 2283006Species Bacillus megaterium [TaxId:1404] [326307] (5 PDB entries)
  8. 2283022Domain d5tkaa_: 5tka A: [326323]
    automated match to d2paua_
    complexed with edo, mg

Details for d5tkaa_

PDB Entry: 5tka (more details), 2.05 Å

PDB Description: structure of the hd-domain phosphohydrolase oxsa
PDB Compounds: (A:) OxsA protein

SCOPe Domain Sequences for d5tkaa_:

Sequence, based on SEQRES records: (download)

>d5tkaa_ a.211.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
sslldiiyqlrqvprwdgsfqfekedvsqhsfsviaishilcelketlegkkinkeklll
yalyhdvtevvsthiispvkknsilkdpfnafreqiknslfdnlpitlsdtlstilnnnd
leiqeivehadhvdayckscievhrgnkdfisiqrslgdkldnltkeypylkefqnlflk
dfplenkny

Sequence, based on observed residues (ATOM records): (download)

>d5tkaa_ a.211.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
sslldiiyqlrqvprwdgsfqfekedvsqhsfsviaishilcelketlegkkinkeklll
yalyhdvtevvsthknslfdnlpitlsdtlstilnnndleiqeivehadhvdayckscie
vhrgnkdfisiqrslgdkldnltkeypylkefqnlflkdfplenkny

SCOPe Domain Coordinates for d5tkaa_:

Click to download the PDB-style file with coordinates for d5tkaa_.
(The format of our PDB-style files is described here.)

Timeline for d5tkaa_:

  • d5tkaa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17