Lineage for d5tqlb_ (5tql B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079054Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 protein domains)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 2079090Protein automated matches [190186] (10 species)
    not a true protein
  7. 2283013Species Thermotoga maritima [TaxId:243274] [326314] (1 PDB entry)
  8. 2283014Domain d5tqlb_: 5tql B: [326315]
    automated match to d1thfd_
    complexed with po4

Details for d5tqlb_

PDB Entry: 5tql (more details), 1.9 Å

PDB Description: crystal structure of tim-barrel protein hisf-c9s
PDB Compounds: (B:) Imidazole glycerol phosphate synthase subunit hisF

SCOPe Domain Sequences for d5tqlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tqlb_ c.1.2.1 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
lakriiasldvkdgrvvkgsnfenlrdsgdpvelgkfyseigidelvflditasvekrkt
mlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfg
sqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksg
ydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeyl
kkhgvnvrl

SCOPe Domain Coordinates for d5tqlb_:

Click to download the PDB-style file with coordinates for d5tqlb_.
(The format of our PDB-style files is described here.)

Timeline for d5tqlb_:

  • d5tqlb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17