SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tqlb_ (5tql B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079054Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 protein domains)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 2079090Protein automated matches [190186] (10 species)
    not a true protein
  7. 2283013Species Thermotoga maritima [TaxId:243274] [326314] (1 PDB entry)
  8. 2283014Domain d5tqlb_: 5tql B: [326315]
    automated match to d1thfd_
    complexed with po4

Details for d5tqlb_

PDB Entry: 5tql (more details), 1.9 Å

PDB Description: crystal structure of tim-barrel protein hisf-c9s
PDB Compounds: (B:) Imidazole glycerol phosphate synthase subunit hisF

SCOPe Domain Sequences for d5tqlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tqlb_ c.1.2.1 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
lakriiasldvkdgrvvkgsnfenlrdsgdpvelgkfyseigidelvflditasvekrkt
mlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfg
sqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksg
ydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeyl
kkhgvnvrl

SCOPe Domain Coordinates for d5tqlb_:

Click to download the PDB-style file with coordinates for d5tqlb_.
(The format of our PDB-style files is described here.)

Timeline for d5tqlb_:

  • d5tqlb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17