SCOPe 2.06: Domain d5t1oa_: 5t1o A:

Lineage for d5t1oa_ (5t1o A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.0: automated matches [191653] (1 protein)
   not a true family

6. Protein automated matches [191210] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [323463] (3 PDB entries)

8. Domain d5t1oa_: 5t1o A: [326312]
   automated match to d1txea_

Details for d5t1oa_

PDB Entry: 5t1o

PDB Description: solution-state nmr and saxs structural ensemble of npr (1-85) in complex with ein-ntr (170-424)

PDB Compounds: (A:) Phosphocarrier protein NPr

SCOPe Domain Sequences for d5t1oa_:

Sequence; same for both SEQRES and ATOM records:

>d5t1oa_ d.94.1.0 (A:) automated matches {Escherichia coli [TaxId: 83334]}
mtvkqtveitnklgmharpamklfelmqgfdaevllrndegteaeansviallmldsakg
rqieveatgpqeeealaavialfns

Timeline for d5t1oa_:

• d5t1oa_ is new in SCOPe 2.06-stable
  
• d5t1oa_ appears in SCOPe 2.07
  
• d5t1oa_ appears in the current release, SCOPe 2.08