Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (2 families) |
Family d.94.1.0: automated matches [191653] (1 protein) not a true family |
Protein automated matches [191210] (2 species) not a true protein |
Species Escherichia coli [TaxId:83334] [323463] (3 PDB entries) |
Domain d5t1oa_: 5t1o A: [326312] automated match to d1txea_ |
PDB Entry: 5t1o (more details)
SCOPe Domain Sequences for d5t1oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t1oa_ d.94.1.0 (A:) automated matches {Escherichia coli [TaxId: 83334]} mtvkqtveitnklgmharpamklfelmqgfdaevllrndegteaeansviallmldsakg rqieveatgpqeeealaavialfns
Timeline for d5t1oa_: