Lineage for d5tqib1 (5tqi B:1-286)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2283008Species Burkholderia multivorans [TaxId:395019] [326309] (1 PDB entry)
  8. 2283009Domain d5tqib1: 5tqi B:1-286 [326310]
    Other proteins in same PDB: d5tqia2, d5tqib2
    automated match to d3pzsb_
    complexed with cl

Details for d5tqib1

PDB Entry: 5tqi (more details), 1.5 Å

PDB Description: crystal structure of a pyridoxal kinase from burkholderia multivorans
PDB Compounds: (B:) Pyridoxal kinase PdxY

SCOPe Domain Sequences for d5tqib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tqib1 c.72.1.0 (B:1-286) automated matches {Burkholderia multivorans [TaxId: 395019]}
mknvlsiqshviyghagnsaavfpmqrlgvnvwplntvqlsnhmqyghwagsaidaakme
qlvdgiaaigalkrcdavlsgfagspaqaratveivravkamnpnawyfcdpamgqtggi
rpepgveefivnempaladgmspnhtelqklagrrietvaeavdacrtliargpkiilvk
hlhdrnspadrfnmlavteteawigqrplyafprhpvgvgdltsaifvarrlrgdsvraa
fehtlaavhavvkatydarryeleliaaqdeiarpsewfgawvtdv

SCOPe Domain Coordinates for d5tqib1:

Click to download the PDB-style file with coordinates for d5tqib1.
(The format of our PDB-style files is described here.)

Timeline for d5tqib1:

  • d5tqib1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5tqib2