SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tk9a_ (5tk9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (8 species)
    not a true protein
  7. 2283006Species Bacillus megaterium [TaxId:1404] [326307] (5 PDB entries)
  8. 2283007Domain d5tk9a_: 5tk9 A: [326308]
    automated match to d2paua_
    complexed with 7d7, mg

Details for d5tk9a_

PDB Entry: 5tk9 (more details), 1.84 Å

PDB Description: structure of the hd-domain phosphohydrolase oxsa with oxetanocin-a bound
PDB Compounds: (A:) OxsA protein

SCOPe Domain Sequences for d5tk9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tk9a_ a.211.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
sslldiiyqlrqvprwdgsfqfekedvsqhsfsviaishilcelketlegkkinkeklll
yalyhdvtevvsthiispvkknsilkdpfnafreqiknslfdnlpitlsdtlstilnnnd
leiqeivehadhvdayckscievhrgnkdfisiqrslgdkldnltkeypylkefqnlflk
dfplenknyry

SCOPe Domain Coordinates for d5tk9a_:

Click to download the PDB-style file with coordinates for d5tk9a_.
(The format of our PDB-style files is described here.)

Timeline for d5tk9a_:

  • d5tk9a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17