SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k1za_ (5k1z A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2126300Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2126301Protein automated matches [190781] (38 species)
    not a true protein
  7. 2126433Species Helicobacter pylori [TaxId:85963] [189517] (16 PDB entries)
  8. 2283005Domain d5k1za_: 5k1z A: [326306]
    automated match to d4p54a_
    complexed with 4ct, dod

Details for d5k1za_

PDB Entry: 5k1z (more details), 2.6 Å

PDB Description: joint x-ray/neutron structure of mtan complex with p-clph-thio-dadme- imma
PDB Compounds: (A:) Aminodeoxyfutalosine nucleosidase

SCOPe Domain Sequences for d5k1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k1za_ c.56.2.0 (A:) automated matches {Helicobacter pylori [TaxId: 85963]}
qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

SCOPe Domain Coordinates for d5k1za_:

Click to download the PDB-style file with coordinates for d5k1za_.
(The format of our PDB-style files is described here.)

Timeline for d5k1za_:

  • d5k1za_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17