SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t1na_ (5t1n A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185502Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2185503Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2185593Family d.94.1.0: automated matches [191653] (1 protein)
    not a true family
  6. 2185594Protein automated matches [191210] (2 species)
    not a true protein
  7. 2280162Species Escherichia coli [TaxId:83334] [323463] (3 PDB entries)
  8. 2283004Domain d5t1na_: 5t1n A: [326305]
    automated match to d1txea_

Details for d5t1na_

PDB Entry: 5t1n (more details)

PDB Description: solution-state nmr structural ensemble of npr (1-85) refined with rdcs and pcs
PDB Compounds: (A:) Phosphocarrier protein NPr

SCOPe Domain Sequences for d5t1na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t1na_ d.94.1.0 (A:) automated matches {Escherichia coli [TaxId: 83334]}
mtvkqtveitnklgmharpamklfelmqgfdaevllrndegteaeansviallmldsakg
rqieveatgpqeeealaavialfns

SCOPe Domain Coordinates for d5t1na_:

Click to download the PDB-style file with coordinates for d5t1na_.
(The format of our PDB-style files is described here.)

Timeline for d5t1na_:

  • d5t1na_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17