Lineage for d5t1na_ (5t1n A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185502Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2185503Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2185593Family d.94.1.0: automated matches [191653] (1 protein)
    not a true family
  6. 2185594Protein automated matches [191210] (2 species)
    not a true protein
  7. 2280162Species Escherichia coli [TaxId:83334] [323463] (3 PDB entries)
  8. 2283004Domain d5t1na_: 5t1n A: [326305]
    automated match to d1txea_

Details for d5t1na_

PDB Entry: 5t1n (more details)

PDB Description: solution-state nmr structural ensemble of npr (1-85) refined with rdcs and pcs
PDB Compounds: (A:) Phosphocarrier protein NPr

SCOPe Domain Sequences for d5t1na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t1na_ d.94.1.0 (A:) automated matches {Escherichia coli [TaxId: 83334]}
mtvkqtveitnklgmharpamklfelmqgfdaevllrndegteaeansviallmldsakg
rqieveatgpqeeealaavialfns

SCOPe Domain Coordinates for d5t1na_:

Click to download the PDB-style file with coordinates for d5t1na_.
(The format of our PDB-style files is described here.)

Timeline for d5t1na_:

  • d5t1na_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17