SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5eria1 (5eri A:22-168)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (65 species)
    not a true protein
  7. 2283000Species Peptoclostridium difficile [TaxId:1496] [326301] (1 PDB entry)
  8. 2283001Domain d5eria1: 5eri A:22-168 [326302]
    Other proteins in same PDB: d5eria2
    automated match to d1lj9a_

Details for d5eria1

PDB Entry: 5eri (more details), 2.3 Å

PDB Description: marr protein from peptoclostridium difficile da00132
PDB Compounds: (A:) MarR family Transcriptional regulator

SCOPe Domain Sequences for d5eria1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eria1 a.4.5.0 (A:22-168) automated matches {Peptoclostridium difficile [TaxId: 1496]}
iktldsnilrevgtlsravnsindikykelklqkgqftfltricenpginlvelsnmlkv
dkatttkaiqklikagyvdkkqdkfdkrgynltptdkslevyeliieeenrsieicfdnf
tdeekqvvtkllekmsknvenewfkvk

SCOPe Domain Coordinates for d5eria1:

Click to download the PDB-style file with coordinates for d5eria1.
(The format of our PDB-style files is described here.)

Timeline for d5eria1:

  • d5eria1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5eria2