Lineage for d5lwpa1 (5lwp A:265-506)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2009679Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2009680Protein automated matches [191142] (6 species)
    not a true protein
  7. 2009693Species Human (Homo sapiens) [TaxId:9606] [189274] (53 PDB entries)
  8. 2282998Domain d5lwpa1: 5lwp A:265-506 [326299]
    Other proteins in same PDB: d5lwpa2
    automated match to d3l0la_
    complexed with 79u

Details for d5lwpa1

PDB Entry: 5lwp (more details), 2.4 Å

PDB Description: discovery of phenoxyindazoles and phenylthioindazoles as rorg inverse agonists
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5lwpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lwpa1 a.123.1.0 (A:265-506) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
lf

SCOPe Domain Coordinates for d5lwpa1:

Click to download the PDB-style file with coordinates for d5lwpa1.
(The format of our PDB-style files is described here.)

Timeline for d5lwpa1:

  • d5lwpa1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5lwpa2