SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lwpa1 (5lwp A:265-506)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2009679Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2009680Protein automated matches [191142] (6 species)
    not a true protein
  7. 2009693Species Human (Homo sapiens) [TaxId:9606] [189274] (53 PDB entries)
  8. 2282998Domain d5lwpa1: 5lwp A:265-506 [326299]
    Other proteins in same PDB: d5lwpa2
    automated match to d3l0la_
    complexed with 79u

Details for d5lwpa1

PDB Entry: 5lwp (more details), 2.4 Å

PDB Description: discovery of phenoxyindazoles and phenylthioindazoles as rorg inverse agonists
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5lwpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lwpa1 a.123.1.0 (A:265-506) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
lf

SCOPe Domain Coordinates for d5lwpa1:

Click to download the PDB-style file with coordinates for d5lwpa1.
(The format of our PDB-style files is described here.)

Timeline for d5lwpa1:

  • d5lwpa1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5lwpa2