Lineage for d5fjob2 (5fjo B:126-368)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087095Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 protein domains)
  6. 2087289Protein automated matches [226997] (13 species)
    not a true protein
  7. 2282906Species Amycolatopsis sp. [TaxId:37632] [326207] (5 PDB entries)
  8. 2282997Domain d5fjob2: 5fjo B:126-368 [326298]
    Other proteins in same PDB: d5fjoa1, d5fjob1
    automated match to d1sjdb1
    complexed with mg, npq; mutant

Details for d5fjob2

PDB Entry: 5fjo (more details), 2.08 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp. ts-1-60: g291d-f323y mutant in complex with n-acetyl naphthylalanine

SCOPe Domain Sequences for d5fjob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjob2 c.1.11.2 (B:126-368) automated matches {Amycolatopsis sp. [TaxId: 37632]}
vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl
lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa
raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgraanval
aslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevttakvw
igs

SCOPe Domain Coordinates for d5fjob2:

Click to download the PDB-style file with coordinates for d5fjob2.
(The format of our PDB-style files is described here.)

Timeline for d5fjob2:

  • d5fjob2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5fjob1