![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 protein domains) |
![]() | Protein automated matches [226997] (13 species) not a true protein |
![]() | Species Amycolatopsis sp. [TaxId:37632] [326207] (5 PDB entries) |
![]() | Domain d5fjob2: 5fjo B:126-368 [326298] Other proteins in same PDB: d5fjoa1, d5fjob1 automated match to d1sjdb1 complexed with mg, npq; mutant |
PDB Entry: 5fjo (more details), 2.08 Å
SCOPe Domain Sequences for d5fjob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fjob2 c.1.11.2 (B:126-368) automated matches {Amycolatopsis sp. [TaxId: 37632]} vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgraanval aslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevttakvw igs
Timeline for d5fjob2: