Lineage for d5fjob1 (5fjo B:1-125)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2171206Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2171207Protein automated matches [226922] (87 species)
    not a true protein
  7. 2171242Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries)
  8. 2282996Domain d5fjob1: 5fjo B:1-125 [326297]
    Other proteins in same PDB: d5fjoa2, d5fjob2
    automated match to d1sjda2
    complexed with mg, npq; mutant

Details for d5fjob1

PDB Entry: 5fjo (more details), 2.08 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp. ts-1-60: g291d-f323y mutant in complex with n-acetyl naphthylalanine

SCOPe Domain Sequences for d5fjob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjob1 d.54.1.0 (B:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

SCOPe Domain Coordinates for d5fjob1:

Click to download the PDB-style file with coordinates for d5fjob1.
(The format of our PDB-style files is described here.)

Timeline for d5fjob1:

  • d5fjob1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5fjob2