SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l2ja2 (5l2j A:184-278)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (831 PDB entries)
  8. 2282993Domain d5l2ja2: 5l2j A:184-278 [326294]
    Other proteins in same PDB: d5l2ja1, d5l2ja3, d5l2jb_
    automated match to d3l9ra2
    complexed with 6ul, 70e, act, bma, cl, fuc, man, na, nag

Details for d5l2ja2

PDB Entry: 5l2j (more details), 1.65 Å

PDB Description: crystal structure of human cd1b in complex with c36-gmm
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d5l2ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l2ja2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywr

SCOPe Domain Coordinates for d5l2ja2:

Click to download the PDB-style file with coordinates for d5l2ja2.
(The format of our PDB-style files is described here.)

Timeline for d5l2ja2:

  • d5l2ja2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from other chains:
(mouse over for more information)
d5l2jb_