Lineage for d5l2ja1 (5l2j A:4-183)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2506506Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2506530Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (15 PDB entries)
  8. 2506535Domain d5l2ja1: 5l2j A:4-183 [326293]
    Other proteins in same PDB: d5l2ja2, d5l2ja3, d5l2jb_
    automated match to d3l9ra1
    complexed with 6ul, 70e, act, bma, cl, fuc, man, na, nag

Details for d5l2ja1

PDB Entry: 5l2j (more details), 1.65 Å

PDB Description: crystal structure of human cd1b in complex with c36-gmm
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d5l2ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l2ja1 d.19.1.1 (A:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev
aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf
lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

SCOPe Domain Coordinates for d5l2ja1:

Click to download the PDB-style file with coordinates for d5l2ja1.
(The format of our PDB-style files is described here.)

Timeline for d5l2ja1:

View in 3D
Domains from other chains:
(mouse over for more information)
d5l2jb_