Lineage for d5l2ja1 (5l2j A:4-183)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163926Protein automated matches [191280] (3 species)
    not a true protein
  7. 2163933Species Human (Homo sapiens) [TaxId:9606] [189896] (31 PDB entries)
  8. 2282992Domain d5l2ja1: 5l2j A:4-183 [326293]
    Other proteins in same PDB: d5l2ja2, d5l2ja3, d5l2jb_
    automated match to d3l9ra1
    complexed with 6ul, 70e, act, bma, cl, fuc, man, na, nag

Details for d5l2ja1

PDB Entry: 5l2j (more details), 1.65 Å

PDB Description: crystal structure of human cd1b in complex with c36-gmm
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d5l2ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l2ja1 d.19.1.1 (A:4-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev
aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf
lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

SCOPe Domain Coordinates for d5l2ja1:

Click to download the PDB-style file with coordinates for d5l2ja1.
(The format of our PDB-style files is described here.)

Timeline for d5l2ja1:

  • d5l2ja1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from other chains:
(mouse over for more information)
d5l2jb_