SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kosb_ (5kos B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060651Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 2060659Species Human (Homo sapiens) [TaxId:9606] [50669] (72 PDB entries)
  8. 2282990Domain d5kosb_: 5kos B: [326291]
    automated match to d1hrna_
    complexed with 6vs, dms, nag, peg

Details for d5kosb_

PDB Entry: 5kos (more details), 2.41 Å

PDB Description: discovery of tak-272: a novel, potent and orally active renin in- hibitor
PDB Compounds: (B:) renin

SCOPe Domain Sequences for d5kosb_:

Sequence, based on SEQRES records: (download)

>d5kosb_ b.50.1.2 (B:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
dippptgptwalgatfirkfytefdrrnnrigfalar

Sequence, based on observed residues (ATOM records): (download)

>d5kosb_ b.50.1.2 (B:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdslggqivlggsdpqhyeg
nfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealga
kkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdippp
tgptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d5kosb_:

Click to download the PDB-style file with coordinates for d5kosb_.
(The format of our PDB-style files is described here.)

Timeline for d5kosb_:

  • d5kosb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17