Lineage for d5kr2d_ (5kr2 D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2058816Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2058832Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2059066Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (471 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 2282988Domain d5kr2d_: 5kr2 D: [326289]
    automated match to d3bvaa_
    complexed with roc

Details for d5kr2d_

PDB Entry: 5kr2 (more details), 1.78 Å

PDB Description: protease pr5-sqv
PDB Compounds: (D:) Protease PR5-SQV

SCOPe Domain Sequences for d5kr2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kr2d_ b.50.1.1 (D:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikvggqlkeallntgaddtviedmnlpgkwkpkmiggiggfikvkqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d5kr2d_:

Click to download the PDB-style file with coordinates for d5kr2d_.
(The format of our PDB-style files is described here.)

Timeline for d5kr2d_:

  • d5kr2d_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17