Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (13 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [326196] (2 PDB entries) |
Domain d5eloc2: 5elo C:194-544 [326286] Other proteins in same PDB: d5eloa1, d5eloa3, d5elob1, d5elob3, d5eloc1, d5eloc3, d5elod1, d5elod3 automated match to d3bjuc2 protein/RNA complex; complexed with edo, krs, lys, so4 |
PDB Entry: 5elo (more details), 1.9 Å
SCOPe Domain Sequences for d5eloc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eloc2 d.104.1.0 (C:194-544) automated matches {Cryptosporidium parvum [TaxId: 353152]} dqevryrqryldlmlneesrkvfklrsraikyirnyfdrlgflevetpmlnmiyggaaar pfityhneletqlymriapelylkqlivggldkvyeigknfrnegidlthnpeftamefy mayadyydlmdlteelisglvleihgslkipyhpdgpegkcieidfttpwkrfsfveeie sglgeklkrpldsqenidfmvemcekheielphprtaaklldklaghfvetkctnpsfii dhpqtmsplakwhrekpemterfelfvlgkelcnaytelneplqqrkffeqqadakasgd veacpidetfclalehglpptggwglgidrlimfladknnikevilfpamr
Timeline for d5eloc2: