Lineage for d5esab2 (5esa B:107-212)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (919 PDB entries)
  8. 2282983Domain d5esab2: 5esa B:107-212 [326284]
    Other proteins in same PDB: d5esab1
    automated match to d1adql2

Details for d5esab2

PDB Entry: 5esa (more details), 2.6 Å

PDB Description: crystal structure of anti-hcv e2 antibody hc84-26
PDB Compounds: (B:) Anti-HCV E2 glycoprotein Fab light chain

SCOPe Domain Sequences for d5esab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5esab2 b.1.1.0 (B:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5esab2:

Click to download the PDB-style file with coordinates for d5esab2.
(The format of our PDB-style files is described here.)

Timeline for d5esab2:

  • d5esab2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17