SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5esab2 (5esa B:107-212)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (847 PDB entries)
  8. 2282983Domain d5esab2: 5esa B:107-212 [326284]
    Other proteins in same PDB: d5esab1
    automated match to d1adql2

Details for d5esab2

PDB Entry: 5esa (more details), 2.6 Å

PDB Description: crystal structure of anti-hcv e2 antibody hc84-26
PDB Compounds: (B:) Anti-HCV E2 glycoprotein Fab light chain

SCOPe Domain Sequences for d5esab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5esab2 b.1.1.0 (B:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5esab2:

Click to download the PDB-style file with coordinates for d5esab2.
(The format of our PDB-style files is described here.)

Timeline for d5esab2:

  • d5esab2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

2282983
d5esab2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5esab1