SCOPe 2.07: Domain d5esab2: 5esa B:107-212

Lineage for d5esab2 (5esa B:107-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1264 PDB entries)

8. Domain d5esab2: 5esa B:107-212 [326284]
   Other proteins in same PDB: d5esab1
   automated match to d1adql2

Details for d5esab2

PDB Entry: 5esa, 2.6 Å

PDB Description: crystal structure of anti-hcv e2 antibody hc84-26

PDB Compounds: (B:) Anti-HCV E2 glycoprotein Fab light chain

SCOPe Domain Sequences for d5esab2:

Sequence; same for both SEQRES and ATOM records:

>d5esab2 b.1.1.0 (B:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d5esab2:

• d5esab2 first appeared in SCOPe 2.06