Lineage for d5ilob1 (5ilo B:2-260)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (233 species)
    not a true protein
  7. 2282948Species Drosophila melanogaster [TaxId:7227] [326249] (2 PDB entries)
  8. 2282971Domain d5ilob1: 5ilo B:2-260 [326272]
    Other proteins in same PDB: d5iloa2, d5ilob2
    automated match to d1mg5a_
    complexed with nad

Details for d5ilob1

PDB Entry: 5ilo (more details), 2.71 Å

PDB Description: crystal structure of photoreceptor dehydrogenase from drosophila melanogaster
PDB Compounds: (B:) Photoreceptor dehydrogenase, isoform C

SCOPe Domain Sequences for d5ilob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ilob1 c.2.1.0 (B:2-260) automated matches {Drosophila melanogaster [TaxId: 7227]}
sfrgknavvtggaggiglqvskqllaagaakvaiidlqdnleefvklraahptqsvmiik
mdvankkgveatyeeiaktfgnidivvnvagifndkdvqrtllvnlggiinstlsalpym
gkdnggkggivvnmssvvgldpmfiipvygatkagiinftrclanekyyqrsgikfvtvc
pgatmtdmftnftekiifpetsdetyrildrlnkqsaadvsrcilnvlekdkngavyvie
gkrvypleikpqwtgkeqa

SCOPe Domain Coordinates for d5ilob1:

Click to download the PDB-style file with coordinates for d5ilob1.
(The format of our PDB-style files is described here.)

Timeline for d5ilob1:

  • d5ilob1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5ilob2