SCOPe 2.08: Domain d5ilob1: 5ilo B:2-260

Lineage for d5ilob1 (5ilo B:2-260)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [326249] (2 PDB entries)

8. Domain d5ilob1: 5ilo B:2-260 [326272]
   Other proteins in same PDB: d5iloa2, d5ilob2
   automated match to d1mg5a_
   complexed with nad

Details for d5ilob1

PDB Entry: 5ilo, 2.71 Å

PDB Description: crystal structure of photoreceptor dehydrogenase from drosophila melanogaster

PDB Compounds: (B:) Photoreceptor dehydrogenase, isoform C

SCOPe Domain Sequences for d5ilob1:

Sequence; same for both SEQRES and ATOM records:

>d5ilob1 c.2.1.0 (B:2-260) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sfrgknavvtggaggiglqvskqllaagaakvaiidlqdnleefvklraahptqsvmiik
mdvankkgveatyeeiaktfgnidivvnvagifndkdvqrtllvnlggiinstlsalpym
gkdnggkggivvnmssvvgldpmfiipvygatkagiinftrclanekyyqrsgikfvtvc
pgatmtdmftnftekiifpetsdetyrildrlnkqsaadvsrcilnvlekdkngavyvie
gkrvypleikpqwtgkeqa

Timeline for d5ilob1:

• d5ilob1 first appeared in SCOPe 2.06
  
• d5ilob1 appears in SCOPe 2.07