SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kb3a1 (5kb3 A:2-230)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2126300Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2126301Protein automated matches [190781] (38 species)
    not a true protein
  7. 2126433Species Helicobacter pylori [TaxId:85963] [189517] (16 PDB entries)
  8. 2282968Domain d5kb3a1: 5kb3 A:2-230 [326269]
    Other proteins in same PDB: d5kb3a2
    automated match to d4p54a_
    complexed with 4ct, mg

Details for d5kb3a1

PDB Entry: 5kb3 (more details), 1.4 Å

PDB Description: 1.4 a resolution structure of helicobacter pylori mtan in complexed with p-clph-dadme-imma
PDB Compounds: (A:) Aminodeoxyfutalosine nucleosidase

SCOPe Domain Sequences for d5kb3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kb3a1 c.56.2.0 (A:2-230) automated matches {Helicobacter pylori [TaxId: 85963]}
qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

SCOPe Domain Coordinates for d5kb3a1:

Click to download the PDB-style file with coordinates for d5kb3a1.
(The format of our PDB-style files is described here.)

Timeline for d5kb3a1:

  • d5kb3a1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5kb3a2