Lineage for d5kb3a1 (5kb3 A:2-230)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2126300Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2126301Protein automated matches [190781] (41 species)
    not a true protein
  7. 2126433Species Helicobacter pylori [TaxId:85963] [189517] (16 PDB entries)
  8. 2282968Domain d5kb3a1: 5kb3 A:2-230 [326269]
    Other proteins in same PDB: d5kb3a2
    automated match to d4p54a_
    complexed with 4ct, mg

Details for d5kb3a1

PDB Entry: 5kb3 (more details), 1.4 Å

PDB Description: 1.4 a resolution structure of helicobacter pylori mtan in complexed with p-clph-dadme-imma
PDB Compounds: (A:) Aminodeoxyfutalosine nucleosidase

SCOPe Domain Sequences for d5kb3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kb3a1 c.56.2.0 (A:2-230) automated matches {Helicobacter pylori [TaxId: 85963]}
qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

SCOPe Domain Coordinates for d5kb3a1:

Click to download the PDB-style file with coordinates for d5kb3a1.
(The format of our PDB-style files is described here.)

Timeline for d5kb3a1:

  • d5kb3a1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5kb3a2