SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jd2d_ (5jd2 D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2063611Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2063612Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2063930Protein automated matches [190191] (2 species)
    not a true protein
  7. 2064009Species Streptomyces avidinii [TaxId:1895] [189343] (44 PDB entries)
  8. 2282959Domain d5jd2d_: 5jd2 D: [326260]
    automated match to d4yvbb_
    complexed with byy

Details for d5jd2d_

PDB Entry: 5jd2 (more details), 1.9 Å

PDB Description: sfx structure of corestreptavidin-selenobiotin complex
PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d5jd2d_:

Sequence, based on SEQRES records: (download)

>d5jd2d_ b.61.1.1 (D:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

Sequence, based on observed residues (ATOM records): (download)

>d5jd2d_ b.61.1.1 (D:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavesryvltgrydsapatdgsgtalgwtva
wknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

SCOPe Domain Coordinates for d5jd2d_:

Click to download the PDB-style file with coordinates for d5jd2d_.
(The format of our PDB-style files is described here.)

Timeline for d5jd2d_:

  • d5jd2d_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17