SCOPe 2.07: Domain d5eicb1: 5eic B:1081-1196

Lineage for d5eicb1 (5eic B:1081-1196)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 protein domains)

6. Protein CREB-binding protein, CBP [74712] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74713] (36 PDB entries)

8. Domain d5eicb1: 5eic B:1081-1196 [326256]
   Other proteins in same PDB: d5eicb2
   automated match to d4nyva_
   complexed with 5j5, edo

Details for d5eicb1

PDB Entry: 5eic, 1.5 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with ayc

PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d5eicb1:

Sequence; same for both SEQRES and ATOM records:

>d5eicb1 a.29.2.1 (B:1081-1196) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

Timeline for d5eicb1:

• d5eicb1 first appeared in SCOPe 2.06