SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fjuc1 (5fju C:1-125)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2171206Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2171207Protein automated matches [226922] (84 species)
    not a true protein
  7. 2171242Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries)
  8. 2282953Domain d5fjuc1: 5fju C:1-125 [326254]
    Other proteins in same PDB: d5fjua2, d5fjub2, d5fjuc2, d5fjud2
    automated match to d1sjda2
    complexed with 5cr, mg; mutant

Details for d5fjuc1

PDB Entry: 5fju (more details), 2.52 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp. ts-1-60: q26a m50i g291d f323y mutant in complex with n-acetyl phenylalanine
PDB Compounds: (C:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d5fjuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjuc1 d.54.1.0 (C:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

SCOPe Domain Coordinates for d5fjuc1:

Click to download the PDB-style file with coordinates for d5fjuc1.
(The format of our PDB-style files is described here.)

Timeline for d5fjuc1:

  • d5fjuc1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17