SCOPe 2.06: Domain d5hgrb1: 5hgr B:3-175

Lineage for d5hgrb1 (5hgr B:3-175)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
   multihelical; array

4. Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families)
   duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
   automatically mapped to Pfam PF09150

5. Family a.175.1.0: automated matches [326230] (1 protein)
   not a true family

6. Protein automated matches [326231] (1 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [326232] (1 PDB entry)

8. Domain d5hgrb1: 5hgr B:3-175 [326247]
   Other proteins in same PDB: d5hgra2, d5hgrb2
   automated match to d1m98a1
   complexed with 45d

Details for d5hgrb1

PDB Entry: 5hgr, 1.68 Å

PDB Description: structure of anabaena (nostoc) sp. pcc 7120 orange carotenoid protein binding canthaxanthin

PDB Compounds: (B:) Orange Carotenoid Protein (OCP)

SCOPe Domain Sequences for d5hgrb1:

Sequence, based on SEQRES records:

>d5hgrb1 a.175.1.0 (B:3-175) automated matches {Nostoc sp. [TaxId: 103690]}
itidsarrifpntlqadavpaltarfnqlsaedqlawtwfaflemgktitvaapgaasmq
faegilkqikemtfeeqtqvmcdlanhtdtpicrtyatwspniklgfwnqlgewmeqgav
apipagyqlsananavletlksldqgqqitvlrssvvdmgfdaakldgytrva

Sequence, based on observed residues (ATOM records):

>d5hgrb1 a.175.1.0 (B:3-175) automated matches {Nostoc sp. [TaxId: 103690]}
itidsarrifpntlqadavpaltarfnqlsaedqlawtwfaflemgktitvaapgaasmq
faegilkqikemtfeeqtqvmcdlanhtdtpicrtyatwspniklgfwnqlgewmeqgav
apipagyqlsananavletlksldqgqqitvlrssvvdmgfdaakva

Timeline for d5hgrb1:

• d5hgrb1 is new in SCOPe 2.06-stable
  
• d5hgrb1 appears in SCOPe 2.07
  
• d5hgrb1 appears in the current release, SCOPe 2.08