SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hgrb1 (5hgr B:3-175)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014191Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 2014192Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 2282929Family a.175.1.0: automated matches [326230] (1 protein)
    not a true family
  6. 2282930Protein automated matches [326231] (1 species)
    not a true protein
  7. 2282931Species Nostoc sp. [TaxId:103690] [326232] (1 PDB entry)
  8. 2282946Domain d5hgrb1: 5hgr B:3-175 [326247]
    Other proteins in same PDB: d5hgra2, d5hgrb2
    automated match to d1m98a1
    complexed with 45d

Details for d5hgrb1

PDB Entry: 5hgr (more details), 1.68 Å

PDB Description: structure of anabaena (nostoc) sp. pcc 7120 orange carotenoid protein binding canthaxanthin
PDB Compounds: (B:) Orange Carotenoid Protein (OCP)

SCOPe Domain Sequences for d5hgrb1:

Sequence, based on SEQRES records: (download)

>d5hgrb1 a.175.1.0 (B:3-175) automated matches {Nostoc sp. [TaxId: 103690]}
itidsarrifpntlqadavpaltarfnqlsaedqlawtwfaflemgktitvaapgaasmq
faegilkqikemtfeeqtqvmcdlanhtdtpicrtyatwspniklgfwnqlgewmeqgav
apipagyqlsananavletlksldqgqqitvlrssvvdmgfdaakldgytrva

Sequence, based on observed residues (ATOM records): (download)

>d5hgrb1 a.175.1.0 (B:3-175) automated matches {Nostoc sp. [TaxId: 103690]}
itidsarrifpntlqadavpaltarfnqlsaedqlawtwfaflemgktitvaapgaasmq
faegilkqikemtfeeqtqvmcdlanhtdtpicrtyatwspniklgfwnqlgewmeqgav
apipagyqlsananavletlksldqgqqitvlrssvvdmgfdaakva

SCOPe Domain Coordinates for d5hgrb1:

Click to download the PDB-style file with coordinates for d5hgrb1.
(The format of our PDB-style files is described here.)

Timeline for d5hgrb1:

  • d5hgrb1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5hgrb2