Lineage for d5hfjf_ (5hfj F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130724Species Helicobacter pylori [TaxId:85962] [225261] (5 PDB entries)
  8. 2282941Domain d5hfjf_: 5hfj F: [326242]
    automated match to d1g60a_
    protein/DNA complex; complexed with sam

Details for d5hfjf_

PDB Entry: 5hfj (more details), 3.1 Å

PDB Description: crystal structure of m1.hpyavi-sam complex
PDB Compounds: (F:) Adenine specific DNA methyltransferase (DpnA)

SCOPe Domain Sequences for d5hfjf_:

Sequence, based on SEQRES records: (download)

>d5hfjf_ c.66.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 85962]}
miqiyhadafeiikdfyqqnlkvdaiitdppynisvknnfptlksakrqgidfgewdknf
kllewiaryaplvnpngcmvifcsyrfisyiadfleengfvvkdfiqwvknnpmprnihr
ryvqdtefalwavkkkakwvfnkpknekylrplilkspvvsglektkhptqkslalmeki
isihtnpndivldpfmgsgttglacknlernfigiesekeyfqtakkrlnl

Sequence, based on observed residues (ATOM records): (download)

>d5hfjf_ c.66.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 85962]}
miqiyhadafeiikdfyqqnlkvdaiitdppnfkllewiaryaplvnpngcmvifcsyrf
isyiadfleengfvvkdfiqwvknnpmprnihrryvqdtefalwavkkkakwvfnkpkne
kylrplilkspptqkslalmekiisihtnpndivldpfmgsgttglacknlernfigies
ekeyfqtakkrlnl

SCOPe Domain Coordinates for d5hfjf_:

Click to download the PDB-style file with coordinates for d5hfjf_.
(The format of our PDB-style files is described here.)

Timeline for d5hfjf_:

  • d5hfjf_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17