SCOPe 2.08: Domain d5fjpd1: 5fjp D:1-125

Lineage for d5fjpd1 (5fjp D:1-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries)

8. Domain d5fjpd1: 5fjp D:1-125 [326240]
   Other proteins in same PDB: d5fjpa2, d5fjpb2, d5fjpc2, d5fjpd2
   automated match to d1sjda2
   complexed with mg, npq; mutant

Details for d5fjpd1

PDB Entry: 5fjp, 2.58 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp ts-1-60: g291d f323y i293g mutant in complex with n-acetyl naphthylalanine

PDB Compounds: (D:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d5fjpd1:

Sequence; same for both SEQRES and ATOM records:

>d5fjpd1 d.54.1.0 (D:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

Timeline for d5fjpd1:

• d5fjpd1 first appeared in SCOPe 2.06
  
• d5fjpd1 appears in SCOPe 2.07