Lineage for d5emze_ (5emz E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158454Protein Ubiquitin [54238] (8 species)
  7. 2158532Species Human (Homo sapiens) [TaxId:9606] [54239] (199 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2282938Domain d5emze_: 5emz E: [326239]
    automated match to d1zgub1
    complexed with so4; mutant

Details for d5emze_

PDB Entry: 5emz (more details), 1.66 Å

PDB Description: crystal structure of k48-linked diubiquitin with f45w mutation in the proximal unit
PDB Compounds: (E:) Polyubiquitin-B

SCOPe Domain Sequences for d5emze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5emze_ d.15.1.1 (E:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d5emze_:

Click to download the PDB-style file with coordinates for d5emze_.
(The format of our PDB-style files is described here.)

Timeline for d5emze_:

  • d5emze_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-17