Lineage for d5hgra2 (5hgr A:176-317)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2506189Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2506190Protein automated matches [190205] (28 species)
    not a true protein
  7. 2506269Species Nostoc sp. [TaxId:103690] [326234] (1 PDB entry)
  8. 2506270Domain d5hgra2: 5hgr A:176-317 [326235]
    Other proteins in same PDB: d5hgra1, d5hgrb1
    automated match to d1m98a2
    complexed with 45d

Details for d5hgra2

PDB Entry: 5hgr (more details), 1.68 Å

PDB Description: structure of anabaena (nostoc) sp. pcc 7120 orange carotenoid protein binding canthaxanthin
PDB Compounds: (A:) Orange Carotenoid Protein (OCP)

SCOPe Domain Sequences for d5hgra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hgra2 d.17.4.0 (A:176-317) automated matches {Nostoc sp. [TaxId: 103690]}
eplvapkdisqrvqvtieginnstvlnymnnlnandfdeliklfvedgalqppfqrpivg
kdailrffreecqnlnllpergvaepaddgytqvkvtgkvqtpwfgaavgmnmawrflln
pqgkiffvaidllaspkellnl

SCOPe Domain Coordinates for d5hgra2:

Click to download the PDB-style file with coordinates for d5hgra2.
(The format of our PDB-style files is described here.)

Timeline for d5hgra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hgra1