SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5d28c_ (5d28 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1991437Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1991528Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains)
  6. 1991681Protein automated matches [190501] (4 species)
    not a true protein
  7. 2282881Species Ovis aries [TaxId:9940] [326182] (2 PDB entries)
  8. 2282920Domain d5d28c_: 5d28 C: [326221]
    automated match to d4rs1a_
    complexed with bma, man, nag, so4

Details for d5d28c_

PDB Entry: 5d28 (more details), 2.85 Å

PDB Description: complex of gm-csf/il-2 inhibition factor with granulocyte-macrophage colony-stimulating factor
PDB Compounds: (C:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d5d28c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d28c_ a.26.1.2 (C:) automated matches {Ovis aries [TaxId: 9940]}
qpspvtrpwqhvdaikealsllndstdtaavmdetvevvsemfdsqeptclqtrlelykq
glrgsltsltgsltmmashykkhcpptqetscetqiitfksfkenlkdflfiipfdcwep

SCOPe Domain Coordinates for d5d28c_:

Click to download the PDB-style file with coordinates for d5d28c_.
(The format of our PDB-style files is described here.)

Timeline for d5d28c_:

  • d5d28c_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-16