SCOPe 2.06: Domain d5fjud1: 5fju D:1-125

Lineage for d5fjud1 (5fju D:1-125)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries)

8. Domain d5fjud1: 5fju D:1-125 [326219]
   Other proteins in same PDB: d5fjua2, d5fjub2, d5fjuc2, d5fjud2
   automated match to d1sjda2
   complexed with 5cr, mg; mutant

Details for d5fjud1

PDB Entry: 5fju, 2.52 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp. ts-1-60: q26a m50i g291d f323y mutant in complex with n-acetyl phenylalanine

PDB Compounds: (D:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d5fjud1:

Sequence; same for both SEQRES and ATOM records:

>d5fjud1 d.54.1.0 (D:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

Timeline for d5fjud1:

• d5fjud1 is new in SCOPe 2.06-stable
  
• d5fjud1 appears in SCOPe 2.07
  
• d5fjud1 appears in the current release, SCOPe 2.08