SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fjpc1 (5fjp C:1-125)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2171206Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2171207Protein automated matches [226922] (84 species)
    not a true protein
  7. 2171242Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries)
  8. 2282905Domain d5fjpc1: 5fjp C:1-125 [326206]
    Other proteins in same PDB: d5fjpa2, d5fjpb2, d5fjpc2, d5fjpd2
    automated match to d1sjda2
    complexed with mg, npq; mutant

Details for d5fjpc1

PDB Entry: 5fjp (more details), 2.58 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp ts-1-60: g291d f323y i293g mutant in complex with n-acetyl naphthylalanine
PDB Compounds: (C:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d5fjpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjpc1 d.54.1.0 (C:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

SCOPe Domain Coordinates for d5fjpc1:

Click to download the PDB-style file with coordinates for d5fjpc1.
(The format of our PDB-style files is described here.)

Timeline for d5fjpc1:

  • d5fjpc1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-16