SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ccea1 (5cce A:2-230)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2126300Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2126301Protein automated matches [190781] (41 species)
    not a true protein
  7. 2126433Species Helicobacter pylori [TaxId:85963] [189517] (16 PDB entries)
  8. 2282885Domain d5ccea1: 5cce A:2-230 [326186]
    Other proteins in same PDB: d5ccea2
    automated match to d4p54a_
    complexed with 2wp, ade, d8u, dod

Details for d5ccea1

PDB Entry: 5cce (more details), 2.5 Å

PDB Description: joint x-ray/neutron structure of wild type mtan complexed with srh and adenine
PDB Compounds: (A:) 5'-Methylthioadenosine Nucleosidase

SCOPe Domain Sequences for d5ccea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ccea1 c.56.2.0 (A:2-230) automated matches {Helicobacter pylori [TaxId: 85963]}
qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

SCOPe Domain Coordinates for d5ccea1:

Click to download the PDB-style file with coordinates for d5ccea1.
(The format of our PDB-style files is described here.)

Timeline for d5ccea1:

  • d5ccea1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-16

View in 3D
Domains from same chain:
(mouse over for more information)
d5ccea2