Lineage for d5d22a_ (5d22 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1991437Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1991528Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains)
  6. 1991681Protein automated matches [190501] (4 species)
    not a true protein
  7. 2282881Species Ovis aries [TaxId:9940] [326182] (2 PDB entries)
  8. 2282884Domain d5d22a_: 5d22 A: [326185]
    automated match to d4rs1a_
    complexed with act, edo

Details for d5d22a_

PDB Entry: 5d22 (more details), 1.99 Å

PDB Description: structure of ovine granulocyte-macrophage colony-stimulating factor
PDB Compounds: (A:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d5d22a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d22a_ a.26.1.2 (A:) automated matches {Ovis aries [TaxId: 9940]}
qpspvtrpwqhvdaikealsllndstdtaavmdetvevvsemfdsqeptclqtrlelykq
glrgsltsltgsltmmashykkhcpptqetscetqiitfksfkenlkdflfiipfdcwep

SCOPe Domain Coordinates for d5d22a_:

Click to download the PDB-style file with coordinates for d5d22a_.
(The format of our PDB-style files is described here.)

Timeline for d5d22a_:

  • d5d22a_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-16