Lineage for d5d28b_ (5d28 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1991437Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1991528Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains)
  6. 1991681Protein automated matches [190501] (4 species)
    not a true protein
  7. 2282881Species Ovis aries [TaxId:9940] [326182] (2 PDB entries)
  8. 2282883Domain d5d28b_: 5d28 B: [326184]
    automated match to d4rs1a_
    complexed with bma, man, nag, so4

Details for d5d28b_

PDB Entry: 5d28 (more details), 2.85 Å

PDB Description: complex of gm-csf/il-2 inhibition factor with granulocyte-macrophage colony-stimulating factor
PDB Compounds: (B:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d5d28b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d28b_ a.26.1.2 (B:) automated matches {Ovis aries [TaxId: 9940]}
qhvdaikealsllndstdtaavmdetvevvsemfdsqeptclqtrlelykqglrgsltsl
tgsltmmashykkhcpptqetscetqiitfksfkenlkdflfiipfdcwep

SCOPe Domain Coordinates for d5d28b_:

Click to download the PDB-style file with coordinates for d5d28b_.
(The format of our PDB-style files is described here.)

Timeline for d5d28b_:

  • d5d28b_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-16