SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5llij_ (5lli J:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158246Protein Elongin B [54246] (2 species)
  7. 2158247Species Human (Homo sapiens) [TaxId:9606] [54247] (29 PDB entries)
  8. 2282874Domain d5llij_: 5lli J: [326175]
    Other proteins in same PDB: d5llib1, d5llib2, d5llic_, d5llie1, d5llie2, d5llif_, d5llih1, d5llih2, d5llii_, d5llik1, d5llik2, d5llil_
    automated match to d1lqba_
    complexed with 6z3

Details for d5llij_

PDB Entry: 5lli (more details), 2.4 Å

PDB Description: pvhl:elob:eloc in complex with vh298
PDB Compounds: (J:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d5llij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llij_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d5llij_:

Click to download the PDB-style file with coordinates for d5llij_.
(The format of our PDB-style files is described here.)

Timeline for d5llij_:

  • d5llij_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13