Lineage for d5tr9a2 (5tr9 A:115-267)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118600Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2118601Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2118771Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2118772Protein automated matches [226871] (18 species)
    not a true protein
  7. 2118835Species Neisseria gonorrhoeae [TaxId:1351790] [324312] (2 PDB entries)
  8. 2118837Domain d5tr9a2: 5tr9 A:115-267 [326173]
    Other proteins in same PDB: d5tr9a1, d5tr9b1
    automated match to d3fpka2
    complexed with cl, edo, fad, mg, na

Details for d5tr9a2

PDB Entry: 5tr9 (more details), 1.65 Å

PDB Description: crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound fad
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d5tr9a2:

Sequence, based on SEQRES records: (download)

>d5tr9a2 c.25.1.0 (A:115-267) automated matches {Neisseria gonorrhoeae [TaxId: 1351790]}
erfpdgkdlvmlctgsgiapflsileqpeirqrfdtvnlihsvsfpeelifndrlaalse
hplvgeyghsfrfvpvttraanpsglsgkripellknnsieqalhtkltpestrfmicgn
pemvkdtfqtlldmgyamhrnripgqimmengf

Sequence, based on observed residues (ATOM records): (download)

>d5tr9a2 c.25.1.0 (A:115-267) automated matches {Neisseria gonorrhoeae [TaxId: 1351790]}
erfpdgkdlvmlctgsgiapflsileqpeirqrfdtvnlihsvsfpeelifndrlaalse
hsfrfvpvttraanpsglsgkripellknnsieqalhtkltpestrfmicgnpemvkdtf
qtlldmgyamhrnripgqimmengf

SCOPe Domain Coordinates for d5tr9a2:

Click to download the PDB-style file with coordinates for d5tr9a2.
(The format of our PDB-style files is described here.)

Timeline for d5tr9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tr9a1