Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (22 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:1351790] [324310] (2 PDB entries) |
Domain d5tr9a1: 5tr9 A:14-114 [326172] Other proteins in same PDB: d5tr9a2, d5tr9b2 automated match to d3fpka1 complexed with cl, edo, fad, mg, na |
PDB Entry: 5tr9 (more details), 1.65 Å
SCOPe Domain Sequences for d5tr9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tr9a1 b.43.4.0 (A:14-114) automated matches {Neisseria gonorrhoeae [TaxId: 1351790]} eakfteekilwvkhhtpklitfaisrpesyrfkagqfsrlgfyegkgfiwraysvvsaey adtleyfavliqdgpmsalfakmqqgdtilldknatgfllp
Timeline for d5tr9a1: