SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5trfa_ (5trf A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996222Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1996223Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1996224Family a.42.1.1: SWIB/MDM2 domain [47593] (5 protein domains)
    Pfam PF02201
  6. 1996231Protein MDM2 [47594] (2 species)
  7. 1996249Species Human (Homo sapiens) [TaxId:9606] [47596] (56 PDB entries)
  8. 2282870Domain d5trfa_: 5trf A: [326171]
    automated match to d2lzga_
    complexed with 7hc, gol, so4

Details for d5trfa_

PDB Entry: 5trf (more details), 2.1 Å

PDB Description: mdm2 in complex with sar405838
PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d5trfa_:

Sequence, based on SEQRES records: (download)

>d5trfa_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyde
kqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn

Sequence, based on observed residues (ATOM records): (download)

>d5trfa_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyqh
ivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn

SCOPe Domain Coordinates for d5trfa_:

Click to download the PDB-style file with coordinates for d5trfa_.
(The format of our PDB-style files is described here.)

Timeline for d5trfa_:

  • d5trfa_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13