Lineage for d5lsem_ (5lse M:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2227758Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2227759Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2227760Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
    L and M are probably related to each other
  6. 2227944Protein automated matches [190224] (9 species)
    not a true protein
  7. 2227960Species Rhodobacter sphaeroides [TaxId:1063] [186985] (33 PDB entries)
  8. 2282868Domain d5lsem_: 5lse M: [326169]
    Other proteins in same PDB: d5lseh1, d5lseh2, d5lsel_
    automated match to d2j8dm_
    complexed with bcl, bph, cdl, d12, fe, lda, po4, spn, u10; mutant

Details for d5lsem_

PDB Entry: 5lse (more details), 2.5 Å

PDB Description: photosynthetic reaction center mutant with glu l212 replaced with ala (chain l, el212w), asp l213 replaced with ala (chain l, dl213a) and leu m215 replaced with ala (chain m, lm215a)
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d5lsem_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lsem_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
ldwtnnfslvhgnlfynpfhglsiaflygsalafamhgatilavsrfggereleqiadrg
taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnhg

SCOPe Domain Coordinates for d5lsem_:

Click to download the PDB-style file with coordinates for d5lsem_.
(The format of our PDB-style files is described here.)

Timeline for d5lsem_:

  • d5lsem_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13