SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ts3b1 (5ts3 B:1-265)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (226 species)
    not a true protein
  7. 2094573Species Brucella melitensis [TaxId:546272] [229171] (2 PDB entries)
  8. 2282863Domain d5ts3b1: 5ts3 B:1-265 [326164]
    Other proteins in same PDB: d5ts3b2
    automated match to d4u8ga_
    complexed with edo, epe, nad

Details for d5ts3b1

PDB Entry: 5ts3 (more details), 1.55 Å

PDB Description: crystal structure of a 3-oxoacyl-[acyl-carrier protein] reductase with bound nad from brucella melitensis
PDB Compounds: (B:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d5ts3b1:

Sequence, based on SEQRES records: (download)

>d5ts3b1 c.2.1.0 (B:1-265) automated matches {Brucella melitensis [TaxId: 546272]}
melteitpeslrlrpshkernvlitgaargigraiaqafversatvgicdlnladvartc
eelnglglgravpiacdvsdydalvaaiddtglvfdtvvnnagispkhngvahkvwemap
dewrrvvdvnltgtfntiraltpgmvearrgwivntssvagktyspivachyaatksaii
gftkhlaaelgpysirvnamapgriatpmvagvapevnaeqvkltpmarlgqpaevadva
lwltstessfvtgqtvdvagglyma

Sequence, based on observed residues (ATOM records): (download)

>d5ts3b1 c.2.1.0 (B:1-265) automated matches {Brucella melitensis [TaxId: 546272]}
melteitpeslrlrpshkernvlitgaargigraiaqafversatvgicdlnladvartc
eelnglglgravpiacdvsdydalvaaiddtglvfdtvvnnagispkhngvahkvwemap
dewrrvvdvnltgtfntiraltpgmvearrgwivntssvagktyspivachyaatksaii
gftkhlaaelgpysirvnamapgriatppevnaeqvkltpmarlgqpaevadvalwltst
essfvtgqtvdvagglyma

SCOPe Domain Coordinates for d5ts3b1:

Click to download the PDB-style file with coordinates for d5ts3b1.
(The format of our PDB-style files is described here.)

Timeline for d5ts3b1:

  • d5ts3b1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5ts3b2
View in 3D
Domains from other chains:
(mouse over for more information)
d5ts3a_