SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tr7b_ (5tr7 B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (37 species)
    not a true protein
  7. 2282800Species Vibrio cholerae [TaxId:243277] [326101] (1 PDB entry)
  8. 2282862Domain d5tr7b_: 5tr7 B: [326163]
    automated match to d1es4a_
    complexed with gol, no2, peg

Details for d5tr7b_

PDB Entry: 5tr7 (more details), 2.05 Å

PDB Description: crystal structure of a putative d-alanyl-d-alanine carboxypeptidase from vibrio cholerae o1 biovar eltor str. n16961
PDB Compounds: (B:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d5tr7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tr7b_ e.3.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
apqiaakgyvlmdyhsgkvlaekemdtklspasltkmmtsyvigqevkrgnislnddvvi
sknawaknfpdsskmfvevgttvkvsdlnrgiiiqsgndacvamaehvagtedafvdlmn
awasslgmknshftnshglddpnlystpydlallgqalirdvpeeyaiyseqkftyngit
qynrngllwdksmnvdgiktghtsgagynlvssategnmrlvavvmgtdnenarkaeskk
llsygfrff

SCOPe Domain Coordinates for d5tr7b_:

Click to download the PDB-style file with coordinates for d5tr7b_.
(The format of our PDB-style files is described here.)

Timeline for d5tr7b_:

  • d5tr7b_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13