SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5llib1 (5lli B:17-112)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2169177Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2169178Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2169179Family d.42.1.1: BTB/POZ domain [54696] (6 protein domains)
  6. 2169237Protein Elongin C [54699] (3 species)
  7. 2169240Species Human (Homo sapiens) [TaxId:9606] [54700] (33 PDB entries)
  8. 2282859Domain d5llib1: 5lli B:17-112 [326160]
    Other proteins in same PDB: d5llia_, d5llib2, d5llic_, d5llid_, d5llie2, d5llif_, d5llig_, d5llih2, d5llii_, d5llij_, d5llik2, d5llil_
    automated match to d1lm8c_
    complexed with 6z3

Details for d5llib1

PDB Entry: 5lli (more details), 2.4 Å

PDB Description: pvhl:elob:eloc in complex with vh298
PDB Compounds: (B:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d5llib1:

Sequence, based on SEQRES records: (download)

>d5llib1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d5llib1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d5llib1:

Click to download the PDB-style file with coordinates for d5llib1.
(The format of our PDB-style files is described here.)

Timeline for d5llib1:

  • d5llib1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13