SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ts2b_ (5ts2 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105663Family c.26.1.3: Adenylyltransferase [52397] (6 protein domains)
  6. 2105820Protein automated matches [190964] (5 species)
    not a true protein
  7. 2282811Species Pseudomonas aeruginosa [TaxId:557722] [326112] (1 PDB entry)
  8. 2282853Domain d5ts2b_: 5ts2 B: [326154]
    Other proteins in same PDB: d5ts2a2, d5ts2c2, d5ts2d2, d5ts2e2, d5ts2f2
    automated match to d4rukb_
    complexed with ca, cl, cod

Details for d5ts2b_

PDB Entry: 5ts2 (more details), 2.3 Å

PDB Description: crystal structure of a phosphopantetheine adenylyltransferase (coad, ppat) from pseudomonas aeruginosa bound to dephospho coenzyme a
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5ts2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ts2b_ c.26.1.3 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 557722]}
mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh
lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps
ekysfisstlvreiaalggdiskfvhpavadalaerfk

SCOPe Domain Coordinates for d5ts2b_:

Click to download the PDB-style file with coordinates for d5ts2b_.
(The format of our PDB-style files is described here.)

Timeline for d5ts2b_:

  • d5ts2b_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13