SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tgbl2 (5tgb L:109-215)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (595 PDB entries)
  8. 2282842Domain d5tgbl2: 5tgb L:109-215 [326143]
    Other proteins in same PDB: d5tgbb1, d5tgbl1
    automated match to d1dn0a2

Details for d5tgbl2

PDB Entry: 5tgb (more details), 2.74 Å

PDB Description: structure of chimeric 02-cb fab, a vrc01-like germline antibody
PDB Compounds: (L:) 02-CB Fab Light Chain

SCOPe Domain Sequences for d5tgbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tgbl2 b.1.1.2 (L:109-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5tgbl2:

Click to download the PDB-style file with coordinates for d5tgbl2.
(The format of our PDB-style files is described here.)

Timeline for d5tgbl2:

  • d5tgbl2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5tgbl1