SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tfsl1 (5tfs L:2-108)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (20 species)
    not a true protein
  7. 2019694Species Human (Homo sapiens) [TaxId:9606] [188740] (158 PDB entries)
  8. 2282839Domain d5tfsl1: 5tfs L:2-108 [326140]
    Other proteins in same PDB: d5tfsl2
    automated match to d1dn0a1
    complexed with so4

Details for d5tfsl1

PDB Entry: 5tfs (more details), 2.32 Å

PDB Description: structure of chimeric 02-k fab, a vrc01-like germline antibody
PDB Compounds: (L:) 02-K Fab Light chain

SCOPe Domain Sequences for d5tfsl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tfsl1 b.1.1.1 (L:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgipd
rfsgsgsgtdftltisrlepedfavyycqqyeffgqgtklei

SCOPe Domain Coordinates for d5tfsl1:

Click to download the PDB-style file with coordinates for d5tfsl1.
(The format of our PDB-style files is described here.)

Timeline for d5tfsl1:

  • d5tfsl1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13