Lineage for d5tfsl1 (5tfs L:2-108)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2019694Species Human (Homo sapiens) [TaxId:9606] [188740] (173 PDB entries)
  8. 2282839Domain d5tfsl1: 5tfs L:2-108 [326140]
    Other proteins in same PDB: d5tfsl2
    automated match to d1dn0a1
    complexed with so4

Details for d5tfsl1

PDB Entry: 5tfs (more details), 2.32 Å

PDB Description: structure of chimeric 02-k fab, a vrc01-like germline antibody
PDB Compounds: (L:) 02-K Fab Light chain

SCOPe Domain Sequences for d5tfsl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tfsl1 b.1.1.1 (L:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgipd
rfsgsgsgtdftltisrlepedfavyycqqyeffgqgtklei

SCOPe Domain Coordinates for d5tfsl1:

Click to download the PDB-style file with coordinates for d5tfsl1.
(The format of our PDB-style files is described here.)

Timeline for d5tfsl1:

  • d5tfsl1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13