Lineage for d5lseh2 (5lse H:36-250)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384684Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2384685Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2384686Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 protein domains)
  6. 2384687Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2384688Species Rhodobacter sphaeroides [TaxId:1063] [50350] (84 PDB entries)
    Uniprot P11846
  8. 2384767Domain d5lseh2: 5lse H:36-250 [326127]
    Other proteins in same PDB: d5lseh1, d5lsel_, d5lsem_
    automated match to d1qovh1
    complexed with bcl, bph, cdl, d12, fe, lda, po4, spn, u10; mutant

Details for d5lseh2

PDB Entry: 5lse (more details), 2.5 Å

PDB Description: photosynthetic reaction center mutant with glu l212 replaced with ala (chain l, el212w), asp l213 replaced with ala (chain l, dl213a) and leu m215 replaced with ala (chain m, lm215a)
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d5lseh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lseh2 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOPe Domain Coordinates for d5lseh2:

Click to download the PDB-style file with coordinates for d5lseh2.
(The format of our PDB-style files is described here.)

Timeline for d5lseh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5lseh1