SCOPe 2.08: Domain d5lseh2: 5lse H:36-250

Lineage for d5lseh2 (5lse H:36-250)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
   Uniprot P11846

8. Domain d5lseh2: 5lse H:36-250 [326127]
   Other proteins in same PDB: d5lseh1, d5lsel_, d5lsem_
   automated match to d1qovh1
   complexed with bcl, bph, cdl, d12, fe, lda, po4, spn, u10; mutant

Details for d5lseh2

PDB Entry: 5lse, 2.5 Å

PDB Description: photosynthetic reaction center mutant with glu l212 replaced with ala (chain l, el212w), asp l213 replaced with ala (chain l, dl213a) and leu m215 replaced with ala (chain m, lm215a)

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d5lseh2:

Sequence; same for both SEQRES and ATOM records:

>d5lseh2 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d5lseh2:

• d5lseh2 first appeared in SCOPe 2.06
  
• d5lseh2 appears in SCOPe 2.07