SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m53a1 (5m53 A:7-271)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198144Protein automated matches [190091] (14 species)
    not a true protein
  7. 2198237Species Human (Homo sapiens) [TaxId:9606] [188447] (583 PDB entries)
  8. 2282819Domain d5m53a1: 5m53 A:7-271 [326120]
    Other proteins in same PDB: d5m53a2
    automated match to d2cl1a_
    complexed with 7gj, edo, peg, po4

Details for d5m53a1

PDB Entry: 5m53 (more details), 1.9 Å

PDB Description: nek2 bound to arylaminopurine inhibitor 11
PDB Compounds: (A:) serine/threonine-protein kinase nek2

SCOPe Domain Sequences for d5m53a1:

Sequence, based on SEQRES records: (download)

>d5m53a1 d.144.1.7 (A:7-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrelkhpn
ivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalke
chrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfakafvgtpyymspe
qmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyrysdelne
iitrmlnlkdyhrpsveeilenpli

Sequence, based on observed residues (ATOM records): (download)

>d5m53a1 d.144.1.7 (A:7-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyevlytigtgsygrcqkirrgkilvwkeldygsmteaekqmlvsevnllrelkhpnivr
yydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalkechr
rsdgghtvlhrdlkpanvfldgkqnvklgdfglvgtpyymspeqmnrmsyneksdiwslg
cllyelcalmppftafsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrpsve
eilenpli

SCOPe Domain Coordinates for d5m53a1:

Click to download the PDB-style file with coordinates for d5m53a1.
(The format of our PDB-style files is described here.)

Timeline for d5m53a1:

  • d5m53a1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5m53a2